PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG015645t1
Common NameTCM_015645
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family HD-ZIP
Protein Properties Length: 239aa    MW: 27405.3 Da    PI: 5.7003
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG015645t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.23.3e-193892256
                      T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                      +++++f++eq++ Le +Fe+ + p  ++++ LA++lgL+ rq+ +WFqNrRa+ k
  Thecc1EG015645t1 38 KNKRRFSDEQIRSLEFMFESGSRPESQKKQLLANELGLQPRQIAIWFQNRRARSK 92
                      67789************************************************99 PP

2HD-ZIP_I/II114.66e-3739130293
       HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                       +krr+s+eq+++LE +Fe+ ++ e+++K+ la+eLglqprq+a+WFqnrRAR k+kq+E+dy+ Lk++ydal+++ e+L++e+++Lr +l++
  Thecc1EG015645t1  39 NKRRFSDEQIRSLEFMFESGSRPESQKKQLLANELGLQPRQIAIWFQNRRARSKSKQIERDYNILKESYDALASSYESLKRENQSLRIQLQK 130
                       79*************************************************************************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.84E-182595IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-172792IPR009057Homeodomain-like
PROSITE profilePS5007117.9613494IPR001356Homeobox domain
SMARTSM003891.4E-163798IPR001356Homeobox domain
CDDcd000861.39E-153895No hitNo description
PfamPF000461.4E-163892IPR001356Homeobox domain
PRINTSPR000317.0E-56574IPR000047Helix-turn-helix motif
PROSITE patternPS0002706992IPR017970Homeobox, conserved site
PRINTSPR000317.0E-57490IPR000047Helix-turn-helix motif
PfamPF021833.3E-1894135IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MLARKEQHQA AATVKVEVGL SGLDLHDHPI TNIKPSSKNK RRFSDEQIRS LEFMFESGSR  60
PESQKKQLLA NELGLQPRQI AIWFQNRRAR SKSKQIERDY NILKESYDAL ASSYESLKRE  120
NQSLRIQLQK LKGQLEMEHG NKTHEPNRTG NSGDGNSENK SVICDANEKI TFLFEGYDHM  180
ISSDNNSRDA ESRDEDRVVL DMMEATDGSL TSSEKWCGFE SNCFLDESSC SSNWWEYW*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18694RRARSKSKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007039388.11e-178Homeobox 7, putative
TrEMBLA0A061GA101e-178A0A061GA10_THECC; Homeobox 7, putative
STRINGPOPTR_0003s14700.16e-56(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM1805779
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46680.13e-43homeobox 7
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]